PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_12466.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 128aa    MW: 14137.1 Da    PI: 10.5142
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_12466.4genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM36.41.5e-111050142
           NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv 42
                  lppGfrF P+d+elv++yL kkv++++ +   ++ evd++ v
  MLOC_12466.4 10 LPPGFRFYPSDQELVCHYLYKKVTNERASQ-GTLVEVDLHAV 50
                  79*************************877.77999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-12851IPR003441NAC domain
PROSITE profilePS5100511.78210128IPR003441NAC domain
PfamPF023651.4E-71139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MGLREIESTL PPGFRFYPSD QELVCHYLYK KVTNERASQG TLVEVDLHAV DERGGVAAVQ  60
LASSRSVPAG RDDGGRLAGA GQRGDGRRLR VLLRLGVRGH GWPWAAWGHA HEVPPRPRVE  120
LMPVVRPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2484801e-131AK248480.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf7e16, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM0UN568e-88M0UN56_HORVD; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.22e-12NAC domain containing protein 74